bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1538_orf1 Length=177 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL0475w 91.3 1e-17 > 5833.PFL0475w Length=842 Score = 91.3 bits (225), Expect = 1e-17, Method: Composition-based stats. Identities = 50/138 (36%), Positives = 74/138 (53%), Gaps = 2/138 (1%) Query 37 DWDADILSLSQNYQGMLQRVGWVLLRPFVSLLGCGNTPVIQLLQHIEARYDPDIPYHTAT 96 DW+ +I ++ + +G+ LL P L + ++ Y DIPYHT+ Sbjct 514 DWNGNIENIYK--ANTFISIGYKLLYPLGVLEANFDKEKLKKFLFRICSYYNDIPYHTSL 571 Query 97 HAAQVAHAAMVLNTKLDLDPGKEKTGSFCLGLAALAHDVGHLGQTNGFLQQSRHPLATIY 156 HAAQVAH + + LD++ FCL +++L HD GH G N FL S + LA Y Sbjct 572 HAAQVAHFSKSMLFMLDMNHKISAIDEFCLHISSLCHDTGHPGLNNYFLINSENNLALTY 631 Query 157 NDRSILENFHASVLFRII 174 ND S+LEN+H S+LF+ + Sbjct 632 NDNSVLENYHCSLLFKTL 649 Lambda K H 0.320 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35195248557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40