bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1488_orf2 Length=94 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0295 73.6 1e-12 > 5833.PF14_0295 Length=462 Score = 73.6 bits (179), Expect = 1e-12, Method: Composition-based stats. Identities = 34/67 (50%), Positives = 48/67 (71%), Gaps = 0/67 (0%) Query 28 ENALVVKAQILAGGRSLGFFKENGYKGGVHACINPKLVFSVANNMINKTLITKQTTKKGR 87 +N LV+KAQ+L+GGR +G+FKEN ++GGVH C N V +A M+N TLITKQ+ +G+ Sbjct 93 DNDLVIKAQVLSGGRGVGYFKENNFEGGVHVCRNSMEVKEIATKMLNNTLITKQSGPEGK 152 Query 88 KVRRLLI 94 K + I Sbjct 153 KCNTVFI 159 Lambda K H 0.316 0.129 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22695718710 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40