bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1475_orf1 Length=144 Score E Sequences producing significant alignments: (Bits) Value 7227.CG10417-PB 105 3e-22 > 7227.CG10417-PB Length=662 Score = 105 bits (263), Expect = 3e-22, Method: Composition-based stats. Identities = 54/123 (43%), Positives = 76/123 (61%), Gaps = 1/123 (0%) Query 13 GGRISRNGSCKWELELVKGFGRLGYKADDSLPPEKQILSGCPDVVTVNRDPEKDEFLVIG 72 GGR++ +G L L + G YK + +LP E+Q++S PD+ + PE DEF+V+ Sbjct 446 GGRVTLDGRVNGGLNLSRALGDHAYKTNVTLPAEEQMISALPDIKKLIITPE-DEFMVLA 504 Query 73 CDGIWELLSSAEVVEFVRRRIEHTPDLCQILKELFDSLISPNPALFEYGCDNMTAFIVDL 132 CDGIW +SS EVVEFVR R++ L I +ELFD+ ++PN GCDNMTA IV Sbjct 505 CDGIWNYMSSEEVVEFVRCRLKDNKKLSTICEELFDNCLAPNTMGDGTGCDNMTAVIVQF 564 Query 133 QAE 135 + + Sbjct 565 KKK 567 Lambda K H 0.319 0.140 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22567178795 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40