bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1427_orf1 Length=140 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G06060.1 90.5 1e-17 > 3702.AT3G06060.1 Length=326 Score = 90.5 bits (223), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 49/139 (35%), Positives = 82/139 (58%), Gaps = 3/139 (2%) Query 5 NIQKTVAMNISTPFLQVKHILPSMLKRKF---GAICFTNSLAAFVPIYGFSTYSATKSAL 61 +++ T+ +N+ F +K LP+M RK +I +S A V +YG++ YSA+K L Sbjct 136 DVKFTIDVNLVGSFNVIKAALPAMKARKDRGPASISLVSSQAGQVGVYGYAAYSASKFGL 195 Query 62 RAFAEVINQEVAGMDVLVANAFLPSVNTPGYEREKQVRHRLTEILEETSKIKQPEEVAEK 121 + A+ + QEV D+ V F P NTPG+E E++ R +T I+ +S + EEVA+K Sbjct 196 QGLAQALQQEVISDDIHVTLIFPPDTNTPGFEEEQKSRPEVTAIIAASSGSMETEEVAKK 255 Query 122 LDDHLEAGHRIITVDFEGW 140 D ++AG+ ++ +FEG+ Sbjct 256 AMDGIKAGNFTVSCNFEGF 274 Lambda K H 0.319 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22914837435 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40