bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1421_orf1 Length=110 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_4380 83.6 2e-15 > 5807.cgd8_4380 Length=431 Score = 83.6 bits (205), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 45/102 (44%), Positives = 60/102 (58%), Gaps = 6/102 (5%) Query 6 DSMFDARLFNQGGGTDSGYKGGEDDTYNLYDRPLFAQRG--GAGIYQFSRDRFASSVGEN 63 +S FDARLFN+ G DSG+ +DT ++YD+PLF G+Y F R S+G Sbjct 329 ESQFDARLFNKVSGLDSGF---SNDTISVYDKPLFNTNNLKHRGLYTFEESRVEESIGGR 385 Query 64 SELASFAGADKTRYT-RTGPVEFEKDVADPFGLDNLLSEAHK 104 + SF+G D ++ RT PVEFE+D DPFGLD L+ K Sbjct 386 VHVPSFSGTDNSKTALRTKPVEFERDEDDPFGLDKLIDSVRK 427 Lambda K H 0.314 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23096258976 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40