bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1417_orf1 Length=138 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G13970.1 66.6 2e-10 > 3702.AT3G13970.1 Length=94 Score = 66.6 bits (161), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 0/68 (0%) Query 69 KVRVHLTAVGEAPRLRLKEFAVDGFETFAAVVNFLQKALKRREIHVYLNSSFKPQPNEYI 128 K+ VHL A G AP L+ +F V G + FA V++FL++ L + VY+NS+F P P+E + Sbjct 11 KIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLHSDSLFVYVNSAFSPNPDESV 70 Query 129 ADLFQKFA 136 DL+ F Sbjct 71 IDLYNNFG 78 Lambda K H 0.318 0.129 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22344559178 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40