bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1375_orf1 Length=67 Score E Sequences producing significant alignments: (Bits) Value 5691.Tb927.6.3340 86.7 2e-16 > 5691.Tb927.6.3340 Length=208 Score = 86.7 bits (213), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 42/65 (64%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Query 1 AHVYVRMPYGQTDYESLPPAVIEEACQLTKHNSIEGCKQSEVTIVYTPASNLKKTASMDT 60 AHVYVRMP G+ + L PA+IEE QLTK NSIEGCK + V +VYTP SNL KT M+ Sbjct 46 AHVYVRMPKGKG-LDDLTPAIIEECSQLTKANSIEGCKLNNVRVVYTPWSNLHKTDGMEV 104 Query 61 GQVGF 65 GQVGF Sbjct 105 GQVGF 109 Lambda K H 0.312 0.127 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22920963996 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40