bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1313_orf1 Length=120 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000093216 72.8 3e-12 > 7955.ENSDARP00000093216 Length=278 Score = 72.8 bits (177), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 34/93 (36%), Positives = 57/93 (61%), Gaps = 3/93 (3%) Query 10 MKGFQIFFETVKSDLTSKLDVIVSVIHFLLVDDDFVCVGVGEKFTDADATGGSELLPSGW 69 M G ++ F V + LT D ++ +H+ +V + C+G+G++ D + +ELLPSGW Sbjct 1 MAGLELLFNCVSNSLTCSQDALICFVHWEIVKSGYKCMGIGDEPKDGEKK--TELLPSGW 58 Query 70 NSNQAIYSLKYRSRHNDKISLLLKGIMAGDLLI 102 N ++ +Y+L+YRS ++DK +LLLK LI Sbjct 59 NESKELYALRYRS-NDDKSNLLLKAFTVDSSLI 90 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40