bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1256_orf1 Length=127 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G60250.1 108 4e-23 > 3702.AT3G60250.1 Length=276 Score = 108 bits (270), Expect = 4e-23, Method: Compositional matrix adjust. Identities = 54/108 (50%), Positives = 73/108 (67%), Gaps = 1/108 (0%) Query 20 DINPHLNEELSDLTGSDLDEDVTWIQWFCGLKGHDNFVLVDEDFVRDDFNLTGLSNQVPY 79 D+ + E SD++GS+ D D +WI WFC L+G+D F VDED+++DDFNL GLS QVPY Sbjct 68 DVESETDSEGSDVSGSEGD-DTSWISWFCNLRGNDFFCEVDEDYIQDDFNLCGLSGQVPY 126 Query 80 YEKALTLIVDGDISDDCPSDSVSFAYIEKSAALLFGLIHARFILTNKG 127 Y+ AL LI+D D S+ +E +A +L+GLIH R+ILT KG Sbjct 127 YDYALDLILDVDASNSEMFTDEQHEMVESAAEMLYGLIHVRYILTTKG 174 Lambda K H 0.317 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22506847341 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40