bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1253_orf1 Length=87 Score E Sequences producing significant alignments: (Bits) Value 4896.SPAC16.03c 77.0 2e-13 > 4896.SPAC16.03c Length=337 Score = 77.0 bits (188), Expect = 2e-13, Method: Composition-based stats. Identities = 43/77 (55%), Positives = 50/77 (64%), Gaps = 4/77 (5%) Query 2 GLTLHIHAE---SRKATALKAEETFLPAFEQIHQRFPGLKIVFEHISTAAAVEAVKG-KK 57 G+ L+IH E S+ T AE FLP +HQRFP LKIV EH +TA AVEAVK + Sbjct 126 GMILNIHGEVPPSKDNTVFTAEPKFLPTLLDLHQRFPKLKIVLEHCTTADAVEAVKACGE 185 Query 58 NVAATITAHHLRLTTGD 74 +VA TITAHHL LT D Sbjct 186 SVAGTITAHHLYLTQKD 202 Lambda K H 0.317 0.129 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22371284777 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40