bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1224_orf1 Length=118 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_2590 84.0 1e-15 > 5807.cgd1_2590 Length=256 Score = 84.0 bits (206), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 40/99 (40%), Positives = 60/99 (60%), Gaps = 6/99 (6%) Query 21 YSLEYLSL------VAQDCLRLLQKQKGFQAIRCPVCSKSIADYSEFWKQLSDEIARTPM 74 YS++ +S+ + +DCL LL + KG ++RCP+CSKS+ D S+ W ++ IA +P+ Sbjct 155 YSIKTVSILNCGHTIHEDCLLLLGEAKGLTSLRCPICSKSLGDNSQIWNEIDKMIAESPI 214 Query 75 EDDMKRKVRIACNDCLERSTTDFHFLGLKCMHCNSFNTR 113 ++ K V I CNDC + T H GLKC C +NTR Sbjct 215 PEESKELVNIFCNDCNIKCNTYSHPYGLKCQTCGGYNTR 253 Lambda K H 0.323 0.135 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22460540320 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40