bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1218_orf1 Length=110 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL007765-PA 67.8 1e-10 > 7159.AAEL007765-PA Length=386 Score = 67.8 bits (164), Expect = 1e-10, Method: Composition-based stats. Identities = 35/82 (42%), Positives = 50/82 (60%), Gaps = 2/82 (2%) Query 1 NRLYVHPGLEDNKQFNKFKQELEKEKQSAETLDFSDGVAAADKINTFVATTTRDHIKNLI 60 N++Y+ F++ Q+ + AE+++F D A A KINT+V T D IK+LI Sbjct 93 NKMYIMQKYSVKSNFHEIAQK--GFRSEAESVNFQDNTATAKKINTWVEQKTNDKIKDLI 150 Query 61 SPSALGAQTRLVLVNALYFKAT 82 SP +L TRLVLVNA++FK T Sbjct 151 SPDSLDDMTRLVLVNAIHFKGT 172 Lambda K H 0.318 0.131 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23096258976 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40