bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1213_orf2 Length=201 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_1170 125 1e-27 > 5807.cgd2_1170 Length=475 Score = 125 bits (313), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 57/135 (42%), Positives = 85/135 (62%), Gaps = 1/135 (0%) Query 56 REEALLLPVERPHCGTQTHNKVCQLFIPGFRECLLFAFSCSICGAKNSVIKTAGAYGQTG 115 E+ + V P+CG + VC++ IPGFR CL+ AF C+ CG K + +K +GAYG+ Sbjct 264 NEDRIKFDVPCPNCGNNGESDVCEIDIPGFRRCLIMAFVCNFCGIKTNELKPSGAYGELA 323 Query 116 RRWILTVEGEEDLNRDVLKGDTSTIIIPSLDFSMEGGAQAGTLTTIEGLIKSLREGLAES 175 ++WILTVE E DLNRD+LK DT++I IP ++ M G+ TT+EG+I + + L + Sbjct 324 KKWILTVESELDLNRDILKSDTASIEIPEIELEMGMGSLGSLFTTVEGMIVKITDSLKDC 383 Query 176 VPFAVGDSAAAASRE 190 F GDSA + ++ Sbjct 384 FTFQ-GDSATSEQKK 397 Lambda K H 0.313 0.130 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 48387021971 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40