bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1182_orf1 Length=155 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G28740.1 133 1e-30 > 3702.AT5G28740.1 Length=917 Score = 133 bits (335), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 57/111 (51%), Positives = 86/111 (77%), Gaps = 1/111 (0%) Query 24 VSLLQTSELFGLARTRKIFEEAIET-LPPKDVRTVCMRYAHVEKCLGEIDRSRAIYQHAA 82 + + + +E+FG+ RTR+I+E+AIE+ LP KDV+ +C+++A +E+ LGEIDR+RA+Y++++ Sbjct 665 IYISRAAEIFGVPRTREIYEQAIESGLPHKDVKIMCIKFAELERSLGEIDRARALYKYSS 724 Query 83 HLCDPSKDQEFWNAWRDLEVAYGNEDTFKDMLRIKRSVIAQYSQVHHNVAE 133 DP D EFWN W + EV +GNEDT+++MLRIKRSV A YSQ H + E Sbjct 725 QFADPRSDPEFWNKWHEFEVQHGNEDTYREMLRIKRSVSASYSQTHFILPE 775 Lambda K H 0.319 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23746592502 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40