bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1180_orf1 Length=137 Score E Sequences producing significant alignments: (Bits) Value 6239.F53A2.4 64.3 9e-10 > 6239.F53A2.4 Length=320 Score = 64.3 bits (155), Expect = 9e-10, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 10/106 (9%) Query 40 KHQVQNATAS-SKSTGEEGSTS------DEERESSRPE-GNGGQTDKYRWTQTLESVDVY 91 K Q +N+ + K EG TS DE+ + +P GNG KY+WTQTL+ ++V Sbjct 114 KEQAKNSVENLEKFVDNEGETSKDAEVEDEDSKLMKPNSGNGADLAKYQWTQTLQELEVK 173 Query 92 VPMGEG--VRASQCQVKITATTLTLGFKGQAPILSGEFSQRVQAED 135 +P+ G +++ VKI T++++G K QAPI+ G+ ++ E+ Sbjct 174 IPIAAGFAIKSRDVVVKIEKTSVSVGLKNQAPIVDGKLPHAIKVEN 219 Lambda K H 0.316 0.129 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22428990562 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40