bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1179_orf1 Length=108 Score E Sequences producing significant alignments: (Bits) Value 42254.ENSSARP00000003075 105 3e-22 > 42254.ENSSARP00000003075 Length=409 Score = 105 bits (263), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 46/106 (43%), Positives = 71/106 (66%), Gaps = 1/106 (0%) Query 1 ALNPMAPNVFATGGADAGVSVWDFRDLRRPAHRLLYIENEALTSLKWHPQNKAVLAAGTT 60 + NP + + ATG AD V++WD R+L+ H ++E + ++W P N+ +LA+ T Sbjct 264 SFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDE-IFQVQWSPHNETILASSGT 322 Query 61 DRFVRIFDCSLIGAEQSPEEAEEGAPEVIFVHGGHVAGITEIDWNP 106 DR + ++D S IG EQSPE+AE+G PE++F+HGGH A I++ WNP Sbjct 323 DRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNP 368 Lambda K H 0.319 0.137 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22451482439 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40