bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1113_orf1 Length=123 Score E Sequences producing significant alignments: (Bits) Value 10141.ENSCPOP00000013421 67.8 8e-11 > 10141.ENSCPOP00000013421 Length=95 Score = 67.8 bits (164), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 38/92 (41%), Positives = 56/92 (60%), Gaps = 5/92 (5%) Query 25 TMVGTNSLSTQASQTTVGGSRVAATRKRVTSKSSTASSGAATISRPRSNAANQGILKFYT 84 T GTN +S+ S +T +R ++T +++ + S S T S A G+ +FYT Sbjct 5 TPSGTNVVSSGRSPSTAVAARASSTVRQLKNASCGTRSAGRTTS-----AGTGGMWRFYT 59 Query 85 EDAPGLRVGPQAVLIMALVFMGVVVMLHIVGK 116 ED+PGL+VGP VL+M+L+F+ V MLHI GK Sbjct 60 EDSPGLKVGPVPVLVMSLLFIAAVFMLHIWGK 91 Lambda K H 0.324 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22834639773 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40