bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1093_orf3 Length=114 Score E Sequences producing significant alignments: (Bits) Value 5691.Tb10.6k15.0580 175 3e-43 > 5691.Tb10.6k15.0580 Length=408 Score = 175 bits (444), Expect = 3e-43, Method: Composition-based stats. Identities = 87/114 (76%), Positives = 94/114 (82%), Gaps = 13/114 (11%) Query 1 PGTGKTLLARAVAHHTSCTFIRVSGGELVQKYIGEGSGMVRELFIMAREHSPSIIFMDEI 60 PGTGKTLLARAVAHHT CTFIRVSG ELVQKYIGEG+ +VRELF+MAREHSPSIIFMDEI Sbjct 193 PGTGKTLLARAVAHHTDCTFIRVSGAELVQKYIGEGARLVRELFVMAREHSPSIIFMDEI 252 Query 61 DSIGSQRVHNTGGGGGGGGGGGGGNGNNDSEVQRTMMELLNQLDGFESNKNIKV 114 DSIGS R+ NTG GG DSEVQRTM+ELLNQLDGFES ++IKV Sbjct 253 DSIGSTRLENTGRGG-------------DSEVQRTMLELLNQLDGFESTQSIKV 293 Lambda K H 0.314 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22778399648 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40