bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1022_orf1 Length=282 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_780 164 2e-39 > 5807.cgd8_780 Length=334 Score = 164 bits (416), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 70/123 (56%), Positives = 90/123 (73%), Gaps = 0/123 (0%) Query 10 KHYTLNEIELGTFRTQLCEQHRRSQCANPDACPHSHCLTWQRRNPYEILYFPQLCPGIEF 69 KHY L EL FRT +C H + +C N D+CP SHCLTWQRRNP + Y P+LCP I F Sbjct 51 KHYLLTIYELYVFRTVVCSSHLQGKCKNSDSCPFSHCLTWQRRNPNDHYYSPKLCPEICF 110 Query 70 RRCNKKMNLVRHCNRGRFCSFAHSKEEELYHPLTYKTHLCSVFPNCLRHFCPFAHHTSEL 129 + N+KMNL+R C +G+ C+FAHSKEE+LYHPL YKT CS++PNC R++CPF+H ++ Sbjct 111 VKSNEKMNLIRRCRKGKLCTFAHSKEEQLYHPLMYKTKECSLYPNCNRYYCPFSHGIEQI 170 Query 130 RDP 132 R P Sbjct 171 RAP 173 Lambda K H 0.320 0.131 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 93999491820 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40