bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0938_orf1 Length=125 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0346 110 1e-23 > 5833.PF14_0346 Length=853 Score = 110 bits (274), Expect = 1e-23, Method: Composition-based stats. Identities = 51/96 (53%), Positives = 69/96 (71%), Gaps = 0/96 (0%) Query 30 KPGGERKAQKAIMQQDDTQAEDARLLNHLEKREKTDSDLSLIRSSLSGNLVCSSLNDSEV 89 K G ER +KAI DD ED+ + +HLE REK D+ +I++SL NLVCS+LND+E+ Sbjct 8 KKGNERNKKKAIFSNDDFTGEDSLMEDHLELREKLSEDIDMIKTSLKNNLVCSTLNDNEI 67 Query 90 EALANAVQFFTFAKGDIVTKQGENGSYFFIVHSGEF 125 L+N +QFF F G++V KQGE GSYFFI++SG+F Sbjct 68 LTLSNYMQFFVFKSGNLVIKQGEKGSYFFIINSGKF 103 Lambda K H 0.308 0.124 0.333 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22670743557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40