bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0929_orf2 Length=141 Score E Sequences producing significant alignments: (Bits) Value 42254.ENSSARP00000009822 63.5 2e-09 > 42254.ENSSARP00000009822 Length=277 Score = 63.5 bits (153), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 35/126 (27%), Positives = 68/126 (53%), Gaps = 4/126 (3%) Query 1 GTRDITIGLAPLFGNNAKVIFLTSNLENAGPPFMSRSNRDRLLSNTVTVKDIDSAVREYL 60 TR++ L P+ + +V+ ++S + S+ ++R +T+T D+ +++++ Sbjct 117 ATRNVCAELLPIMKPHGRVVNISSLQGSRALEHCSQELQERFRCDTLTEDDLVDLMKKFV 176 Query 61 QVAPTDWRQK-GWPNQPYFFSKTAVIGLTAALARQAEKGTLNPDAEGIIITACYPGWCKT 119 + A + ++ GWP+ Y SK V L+ LAR+ ++ + I++ AC PGW KT Sbjct 177 EDARNEVHEREGWPSSAYGVSKLGVTVLSRILARRLQE---TRSGDRILLNACCPGWVKT 233 Query 120 DMAGWE 125 DMAG + Sbjct 234 DMAGEQ 239 Lambda K H 0.318 0.134 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40