bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0912_orf1 Length=145 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL1645w 72.4 4e-12 > 5833.PFL1645w Length=3896 Score = 72.4 bits (176), Expect = 4e-12, Method: Composition-based stats. Identities = 30/88 (34%), Positives = 59/88 (67%), Gaps = 0/88 (0%) Query 9 IDALNVSFARVVNLLLQQQTFKPFVNRVDDRVAPGYSVVVQHPMFLRKVLSKCRERQYTS 68 I+ N + + ++ + + +K F+N V++ AP Y V++ PM++ K++ +C++++Y S Sbjct 3699 IENFNDTLSNIMTDISKLNNYKAFLNEVNESYAPLYYTVIKKPMYINKIIFRCKKKKYNS 3758 Query 69 VAAFKDDINLIVSNCLLFNPVGSPSAWL 96 + +F +D+NLIV+NC L+N S SA+L Sbjct 3759 LNSFFEDVNLIVTNCKLYNTPTSVSAYL 3786 Lambda K H 0.322 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22480264135 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40