bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0871_orf1 Length=172 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI1215w 207 1e-52 > 5833.PFI1215w Length=589 Score = 207 bits (527), Expect = 1e-52, Method: Compositional matrix adjust. Identities = 86/115 (74%), Positives = 104/115 (90%), Gaps = 0/115 (0%) Query 58 PIYNPLNLPLGFDGRPIPYWLYKLHGLGQEFKCEICGNFSYWGRRAFERHFSEWRHSFGM 117 PIYNPLNLPLGFD +PIPYWLYKLHGL +E+KCEICGN+SY+GR FE+HF EWRHSFGM Sbjct 464 PIYNPLNLPLGFDNKPIPYWLYKLHGLSKEYKCEICGNYSYFGRATFEKHFYEWRHSFGM 523 Query 118 RCLKIPNTTHFKEITKIEDAILLYEKLKQQAEGHAFKQDQELECEDAEGNVMSLR 172 +CLKIPNT HFKEITKIEDA+ LYEKLK++ + + FK DQE+ECED++GNVM+++ Sbjct 524 KCLKIPNTLHFKEITKIEDALNLYEKLKKETQMNIFKPDQEVECEDSKGNVMNIK 578 Lambda K H 0.315 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32857020181 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40