bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0865_orf1 Length=78 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_730 80.9 1e-14 > 5807.cgd3_730 Length=419 Score = 80.9 bits (198), Expect = 1e-14, Method: Composition-based stats. Identities = 37/66 (56%), Positives = 52/66 (78%), Gaps = 1/66 (1%) Query 3 LGANVLLVDYRGFGHSGGSPTEEGVYRDADAALDFILNSQDVNNKD-IFVVGHSMGGAVA 61 +G N+ V YRG+G S G+P+EEG Y DA A+L+++L+ DV +K+ IF+ GHS+GGAVA Sbjct 191 IGVNIFAVSYRGYGDSEGTPSEEGFYLDAKASLEYVLSRTDVVDKNMIFLYGHSIGGAVA 250 Query 62 IDLASR 67 IDLAS+ Sbjct 251 IDLASK 256 Lambda K H 0.318 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23019419813 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40