bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0797_orf1 Length=79 Score E Sequences producing significant alignments: (Bits) Value 9606.ENSP00000283109 102 5e-21 > 9606.ENSP00000283109 Length=552 Score = 102 bits (253), Expect = 5e-21, Method: Composition-based stats. Identities = 44/70 (62%), Positives = 56/70 (80%), Gaps = 0/70 (0%) Query 1 VLEKLMKLIVRLAHCGLIHGDFSEFNIMISEKGHITMIDLPQMVSIYHPNAALYFDRDVE 60 V ++ M+LIV+LA+ GLIHGDF+EFN+++ E HITMID PQMVS HPNA YFDRDV+ Sbjct 208 VYDEAMELIVKLANHGLIHGDFNEFNLILDESDHITMIDFPQMVSTSHPNAEWYFDRDVK 267 Query 61 CIKRLFERKF 70 CIK F ++F Sbjct 268 CIKDFFMKRF 277 Lambda K H 0.330 0.145 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22947404809 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40