bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0727_orf1 Length=145 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G74310.1 171 5e-42 > 3702.AT1G74310.1 Length=911 Score = 171 bits (433), Expect = 5e-42, Method: Compositional matrix adjust. Identities = 87/143 (60%), Positives = 109/143 (76%), Gaps = 0/143 (0%) Query 1 VHVHEPSVSATISILRGLKDRYAAHHGVRILDSALVEAAQLADRYITSRFLPDKAIDLMD 60 V+V EPSV TISILRGLK++Y HHGVRI D AL+ AAQL+ RYIT R LPDKAIDL+D Sbjct 337 VYVAEPSVPDTISILRGLKEKYEGHHGVRIQDRALINAAQLSARYITGRHLPDKAIDLVD 396 Query 61 EACAIARVQVDSKPEVMDRLERFIFQLEVEATALSKESDAASQERLTEVRQEIAKHRETL 120 EACA RVQ+DS+PE +D LER QLE+E AL +E D AS+ RL EVR+E+ R+ L Sbjct 397 EACANVRVQLDSQPEEIDNLERKRMQLEIELHALEREKDKASKARLIEVRKELDDLRDKL 456 Query 121 KPLQIQYTREKETLDELRQLALK 143 +PL ++Y +EKE +DE+R+L K Sbjct 457 QPLTMKYRKEKERIDEIRRLKQK 479 Lambda K H 0.317 0.131 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22480264135 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40