bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0698_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value 4952.YALI0E14058g 97.8 7e-20 > 4952.YALI0E14058g Length=406 Score = 97.8 bits (242), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 54/113 (47%), Positives = 68/113 (60%), Gaps = 10/113 (8%) Query 1 GGRGGYQGGQGGGYQGNNQQGTSGSSYQGGSGGGGGRQVFVSNLPWKTSWHDLKDLFREC 60 G R G + +GG + G+ Q G GG G Q+FV NLP+ T W DLKDLFRE Sbjct 169 GARDGGRSERGGDFGGSRQSG----------GGAPGTQLFVGNLPYSTGWQDLKDLFREA 218 Query 61 GEVIRADVMELPGGRSKGVGTVLFASRESAQTAIDTFNNYLLDGRHISVRFDR 113 G+++RAD+M GRSKG G VLF + E A AI+ FN + + GR I VR DR Sbjct 219 GQIVRADIMTSHDGRSKGSGIVLFETAEDAHRAIERFNGHQMGGRAIEVREDR 271 Lambda K H 0.315 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22619469984 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40