bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0633_orf1 Length=111 Score E Sequences producing significant alignments: (Bits) Value 5833.PF08_0054 197 6e-50 > 5833.PF08_0054 Length=677 Score = 197 bits (502), Expect = 6e-50, Method: Compositional matrix adjust. Identities = 96/111 (86%), Positives = 102/111 (91%), Gaps = 0/111 (0%) Query 1 PEEISAMVLMKMKEIAEQFIGKEIKEAVITVPAYFNDSQRQATKDAGTIVGLNVLRIINE 60 PEEIS+MVL KMKE AE F+GK IK AVITVPAYFNDSQRQATKDAGTI GLNV+RIINE Sbjct 128 PEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFNDSQRQATKDAGTIAGLNVMRIINE 187 Query 61 PTAAAIAYGLDKKGQGEMNVLIFDMGGGTFDVSLLTIEDGILEVKATAGDT 111 PTAAAIAYGL KKG+GE N+LIFD+GGGTFDVSLLTIEDGI EVKATAGDT Sbjct 188 PTAAAIAYGLHKKGKGEKNILIFDLGGGTFDVSLLTIEDGIFEVKATAGDT 238 Lambda K H 0.316 0.135 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23016794144 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40