bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0630_orf2 Length=155 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL1P2.34 142 3e-33 > 5833.MAL1P2.34 Length=367 Score = 142 bits (358), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 70/146 (47%), Positives = 102/146 (69%), Gaps = 1/146 (0%) Query 1 RLIAEAFCLRDYILERAKEIAKELLDAGQLRSRSTCVCMLAITYLACREGGATRTVKELI 60 +LI + F LR ++ERAKEI KEL D QL++R + MLA+ YLACRE G +++KELI Sbjct 153 KLICDTFFLRSNVIERAKEITKELQDMEQLKNRINNLNMLAVVYLACREAGHIKSIKELI 212 Query 61 VYDRSIKEKELGKQINKIKRLLPNRGGGNNQENVQQLLPRYCSKLQLSMHVSDVAEYVAK 120 +DRS KEK+LGK INK+K++LP+R N EN+ L+ ++LQLS+ + + EYV K Sbjct 213 TFDRSYKEKDLGKTINKLKKVLPSRAFVYN-ENISHLIYSLSNRLQLSIDLIEAIEYVVK 271 Query 121 RAAQVFVSSHRPNSVAAAAIWLVVQL 146 +A+ + +SHR NS+ +I L+V+L Sbjct 272 KASTLITTSHRLNSLCGGSIHLIVEL 297 Lambda K H 0.319 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23746592502 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40