bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0623_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value 6239.Y34D9A.6.1 112 3e-24 > 6239.Y34D9A.6.1 Length=105 Score = 112 bits (280), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 55/95 (57%), Positives = 68/95 (71%), Gaps = 2/95 (2%) Query 29 WVDDLVDGHKIMVFSKSYCPYCQRAISALSSLNVSDMHVEQIE--NNPFCDAIQDYLKTK 86 +VD L+ K++VFSKSYCPYC +A +AL S+NV ++ IE C+ IQDYL + Sbjct 5 FVDGLLQSSKVVVFSKSYCPYCHKARAALESVNVKPDALQWIEIDERKDCNEIQDYLGSL 64 Query 87 TGARSVPRVFINGKFFGGGDDTVEGVRSGTLQKLL 121 TGARSVPRVFINGKFFGGGDDT G ++G L LL Sbjct 65 TGARSVPRVFINGKFFGGGDDTAAGAKNGKLAALL 99 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22998535989 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40