bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0607_orf1 Length=110 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL0650c 113 2e-24 > 5833.PFL0650c Length=576 Score = 113 bits (282), Expect = 2e-24, Method: Composition-based stats. Identities = 45/109 (41%), Positives = 63/109 (57%), Gaps = 0/109 (0%) Query 2 IIDQYAGEPPCPRWKHAAAFFDNRLWIMGGTYAGWFKNYVMSDLYVFDFSARVWFRCDVN 61 ++ +GE PCPRWKH A FD +WI GG +GWF NY + DLYV+D + WF C + Sbjct 350 LMKNSSGEAPCPRWKHGAVIFDKNMWISGGLCSGWFSNYSIPDLYVYDIPSNCWFNCQIA 409 Query 62 PTDLGFHTDVGPLTVLPANRAIYIFGGADQRGYPCADVYRLAPVCTTVS 110 + D G L + +A ++FGG + P ++V R AP+CT VS Sbjct 410 SKQIHNCYDYGTLNLHSQTKAFFLFGGKNANNDPTSNVCRFAPLCTNVS 458 Lambda K H 0.328 0.144 0.510 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23096258976 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40