bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0604_orf1 Length=120 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_3850 129 3e-29 > 5807.cgd8_3850 Length=368 Score = 129 bits (324), Expect = 3e-29, Method: Composition-based stats. Identities = 57/101 (56%), Positives = 77/101 (76%), Gaps = 1/101 (0%) Query 10 HDTGRAGAAQHASTA-QSLARILREHRDIQRNASPHWTAAPLSLEEPREWHFTLRGPPDS 68 H TG G T+ Q L+RILRE+R+IQ+ S +W A P++++EP EWHFT++GP + Sbjct 34 HQTGARGVGSSGITSVQCLSRILREYREIQKEPSSYWCAFPINMDEPYEWHFTIKGPAGT 93 Query 69 PFEGGLYHGRIVLPKNYPFAPPSLMLLTRNGRFDINKKVRL 109 FEGG+YHGRI+LP +YPF+PPSLM+LT NGRF++ KKV L Sbjct 94 EFEGGMYHGRIILPHSYPFSPPSLMMLTGNGRFEVGKKVCL 134 Lambda K H 0.321 0.135 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40