bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0583_orf1 Length=146 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000017986 73.9 1e-12 > 7719.ENSCINP00000017986 Length=637 Score = 73.9 bits (180), Expect = 1e-12, Method: Composition-based stats. Identities = 54/157 (34%), Positives = 74/157 (47%), Gaps = 23/157 (14%) Query 3 EDQVQLAPEELRQRMPPKILYPQNPRAPQNITRFSFKENQFKKEGAVEQTVFHLFIDSTL 62 +DQ+ L EL++ +IL NP APQNI RF+FKE +K+ +VEQ H +D + Sbjct 10 DDQLDLTEVELKEEFT-RILTANNPHAPQNIVRFNFKERTYKQTSSVEQIAIHFALDGNM 68 Query 63 LLKDSPEAAEQ------------------EELLRLRDEAEERRRELEAVEVSIEDDGATQ 104 L KDS EA Q E L E E E E +E + Sbjct 69 LHKDSDEARRQRAKAGMGESKSNFVCLNSEAALSEAGEEEGGEGEDGEKEEVVEAPPPKK 128 Query 105 EEEGRVMRNQFNNVDRATQIKSCPTVEQSCSTLPPPK 141 E +RNQFN +RA+Q + P E+ +T PPP+ Sbjct 129 ES----LRNQFNFSERASQTFNNPYRERGTATEPPPR 161 Lambda K H 0.313 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22393349475 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40