bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0541_orf1 Length=159 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE1415w 70.1 2e-11 > 5833.PFE1415w Length=406 Score = 70.1 bits (170), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 46/156 (29%), Positives = 71/156 (45%), Gaps = 36/156 (23%) Query 4 EWLRCLPLLFLMIIVIYIDLVYILLHCLPQLQLSRPPALRDARRFQRGTYELVVFIALSF 63 +++R LP+ F+ I+++ I L+YI+ HCLP L + +RG E+ VF Sbjct 108 KFVRLLPVFFIFIVLLGIYLIYIMYHCLP-LIYKDYKKVYLKYDLKRGIIEMGVFHFCLI 166 Query 64 LFLMSYWLSVITPAGSIPRTDQWTIKEEEEGEEEEGEEEGGGGGRGRGRRGRGGIRGGGQ 123 ++L++Y LS+I GSIP T++W++ + +E E Sbjct 167 MYLINYILSIIVSPGSIPDTEEWSLNDFQENNNINMENI--------------------- 205 Query 124 EGEEEEEEETPIANAIETKKGGGRRWCKWCKIYKPD 159 +E KK G RR CKWC YKPD Sbjct 206 --------------LLEKKKSGERRHCKWCCKYKPD 227 Lambda K H 0.321 0.144 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26246233818 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40