bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0510_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 10141.ENSCPOP00000000862 154 1e-36 > 10141.ENSCPOP00000000862 Length=802 Score = 154 bits (388), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 82/132 (62%), Positives = 102/132 (77%), Gaps = 2/132 (1%) Query 1 LRPGEIDPHPETKPSRADPIDMAEDEKEMLEEARARLANTRGKKAKRKAREKQLEEARRL 60 L+PGEIDP+PETKP+R DPIDM EDE EML EARARLANT+GKK KRKAREKQLEEARRL Sbjct 123 LKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKGKRKAREKQLEEARRL 182 Query 61 AALQKKRELKAAGIITGAKRRTRKNFQPYEEVPFEEKPPPGFYEVPSEENPEG-NLNFAN 119 AALQK+REL+AAGI KR+ ++ E+PFE+KP GFY+ SEEN + + +F Sbjct 183 AALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDT-SEENYQALDADFRK 241 Query 120 ISLQHMEGHMRA 131 + Q ++G +R+ Sbjct 242 LRQQDLDGELRS 253 Lambda K H 0.311 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40