bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0469_orf1 Length=140 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL2225w 110 2e-23 > 5833.PFL2225w Length=204 Score = 110 bits (274), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 52/123 (42%), Positives = 79/123 (64%), Gaps = 0/123 (0%) Query 15 YNERASGGKVSTTDAAVLARQLGLAPSYADVEKFEQENGSQLDYSTFQQFAAQSTHPEDN 74 +NE++SGGK+S +A+ AR+LGLAPS D +K ++ G L Y + ++ + H +DN Sbjct 81 FNEKSSGGKISIDNASYNARKLGLAPSSIDEKKIKELYGDNLTYEQYLEYLSICVHDKDN 140 Query 75 IEDLVGAFAHFDPNGSGSLTVQQMRNILMTFGEPLTKEEMGVVESKFFSGTTVDYREFCT 134 +E+L+ FAHFD N +G LT QM+NIL T+G+ LT +E + F S +DY+ FC Sbjct 141 VEELIKMFAHFDNNCTGYLTKSQMKNILTTWGDALTDQEAIDALNAFSSEDNIDYKLFCE 200 Query 135 RVL 137 +L Sbjct 201 DIL 203 Lambda K H 0.314 0.130 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22914837435 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40