bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0334_orf1 Length=148 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL2425w 168 3e-41 > 5833.PFL2425w Length=153 Score = 168 bits (426), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 75/138 (54%), Positives = 106/138 (76%), Gaps = 4/138 (2%) Query 11 MIKSVVVVNTQGKPRIVRFYDGTPQEKHQHVMKSLFAAVSRRPSEGCCCFTENTDLFGPN 70 MIK V+V+N GKPR +RFYD + EK Q + K ++ + R CCCF E+ +LF + Sbjct 1 MIKGVLVINNNGKPRFLRFYDESNHEKQQLITKRVYELIKNRLDRECCCFIEDEELFSSD 60 Query 71 HRIIYRHFATLFFIFVTDNLESELGLLDLIQVVVQVLDACFENVCELDLVFHYDKINYIL 130 +++YRHFATL+F+F+ D++ESELG+LDLI QVLD+ FENVCELDL+++Y++INYIL Sbjct 61 IKVVYRHFATLYFVFIIDSMESELGILDLI----QVLDSNFENVCELDLIYNYEQINYIL 116 Query 131 DEIIVGGLVMETGVDNIL 148 DEII+GG+V+ET +D I+ Sbjct 117 DEIIMGGIVLETNIDTII 134 Lambda K H 0.328 0.145 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22943761524 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40