bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0329_orf2 Length=211 Score E Sequences producing significant alignments: (Bits) Value 5691.Tb09.211.3330 162 6e-39 > 5691.Tb09.211.3330 Length=445 Score = 162 bits (410), Expect = 6e-39, Method: Compositional matrix adjust. Identities = 88/210 (41%), Positives = 119/210 (56%), Gaps = 41/210 (19%) Query 2 AACFSSGMAATITVLTAYLSAGDHCIMPICLYGGTFRAANEYVSRFGVEFDFVDFRDPSQ 61 A +S+GMAAT TV++A ++AGDH I+ C YGGT RA + +RFG+EF FVD RD S Sbjct 127 ATVYSTGMAATTTVVSALMNAGDHAIVTDCSYGGTNRACRVFFTRFGMEFTFVDMRDLSN 186 Query 62 VEKAFKDNTKMVLAETPANPTLHLTDLEAIDMIIAKKELERLRNKQKTENATPSTDAAPV 121 VEKA K NTK+V++ETPANPTL LTD+ A+ I Sbjct 187 VEKAIKSNTKLVISETPANPTLTLTDIRALSKIC-------------------------- 220 Query 122 SDDELLKTISGGNREKERSILFVVDSTFATPHVLHPFEYGADIILHSTTKYFDGHNITTG 181 K + +L V D+TFAT ++ P + GAD+ L STTK+ DGHN+T G Sbjct 221 ---------------KAKGLLHVCDNTFATAFIMRPIDLGADVSLISTTKFVDGHNMTVG 265 Query 182 GAAISRFLKYHDKIAYTRNICGSIMDPQTA 211 GA +++ +K+ T+NI G+ M P A Sbjct 266 GALVTKRKDLDEKLRLTQNILGNAMSPFVA 295 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 53680939224 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40