bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0315_orf3 Length=139 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_4340 82.0 5e-15 > 5807.cgd2_4340 Length=563 Score = 82.0 bits (201), Expect = 5e-15, Method: Composition-based stats. Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 49/130 (37%) Query 2 EALNLLKRMLVFNPKRRISVDECLAHPFFKEVRNPAIEVCMMHAALLSLFWFCLEAFAPS 61 ++++LLK+MLVFNP +RI+VDE L+H FK +RN Sbjct 478 QSIDLLKKMLVFNPNKRITVDEALSHSLFKNIRNEM------------------------ 513 Query 62 DGLCVHSSSTLFPASSDEHPILHVPLQVTANEKVRLPFNDWANMDEPQLRLGFLREMQRF 121 L++ ++EKV LPF+DW++M E +LR FL+E+QRF Sbjct 514 -------------------------LEIISHEKVTLPFDDWSSMTERELRYFFLKEIQRF 548 Query 122 HPNLQLPKTL 131 P+L +P ++ Sbjct 549 SPDLVIPDSI 558 Lambda K H 0.326 0.138 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23001752095 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40