bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0311_orf1 Length=111 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G10350.1 105 4e-22 > 3702.AT1G10350.1 Length=349 Score = 105 bits (262), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 47/72 (65%), Positives = 63/72 (87%), Gaps = 2/72 (2%) Query 39 MGKDYYRILGVSRDASEADLKKAYRKLAIKWHPDKHSNPEAKQKAEAQFKDIAEAYDVLS 98 MG DYY +L V+R+A+E DLKK+YR++A+KWHPDK NP +K++AEA+FK I+EAYDVLS Sbjct 1 MGVDYYNVLKVNRNANEDDLKKSYRRMAMKWHPDK--NPTSKKEAEAKFKQISEAYDVLS 58 Query 99 DKERRQIYDKFG 110 D +RRQIYD++G Sbjct 59 DPQRRQIYDQYG 70 Lambda K H 0.310 0.123 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23016794144 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40