bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0246_orf1 Length=156 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G35740.1 78.6 5e-14 > 3702.AT2G35740.1 Length=580 Score = 78.6 bits (192), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 44/146 (30%), Positives = 77/146 (52%), Gaps = 5/146 (3%) Query 8 VDEYFSLCNNNNISCSHKTLFVSILAPGAVVGSVSGGWVADRLGRRPGLLLSDLFLLIAS 67 + E F +N + + VS+ GA+VG+ GGW D+ GRR +L++D+ L+ + Sbjct 54 IKEEFGEVDNKTW---LQEIIVSMTVAGAIVGAAIGGWYNDKFGRRMSVLIADVLFLLGA 110 Query 68 LCFGIGSSFGLVLAGRFFVGLGVGMGFVVYATYMCEVAPNKLRGIHVACQEVAQCSGCMF 127 L I + +++ GR VG GVGM + Y+ E++P ++RG V+ + G Sbjct 111 LVMVIAHAPWVIILGRLLVGFGVGMASMTSPLYISEMSPARIRGALVSTNGLLITGGQFL 170 Query 128 AYVLAAIFGGSP--WKIMMGSAGIAA 151 +Y++ F +P W+ M+G + I A Sbjct 171 SYLINLAFVHTPGTWRWMLGVSAIPA 196 Lambda K H 0.327 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 24371502831 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40