bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0194_orf1 Length=128 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_4740 77.8 8e-14 > 5807.cgd8_4740 Length=267 Score = 77.8 bits (190), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 49/138 (35%), Positives = 74/138 (53%), Gaps = 18/138 (13%) Query 1 DRLRALSSRLLQRLLLSSYCCCNPQHIVIERKETRSKPIWKPSPGETADFVHFNVSHDEG 60 DR R+L S LL +L L +Y +P+ + I R E KP +K E+ +HFNVSHD Sbjct 8 DRKRSLLSVLLMKLALMNYYDISPKQVKIIR-EKGMKPYFK-YDSESDSLLHFNVSHDGD 65 Query 61 LVVFGASRHLVGVDCMRC--SPRGRDISS--------FLQQMRRHCTLRDWSYIIAVHTP 110 +VV S+++VG+D M+ SP +S+ FL M+ +W YI Sbjct 66 VVVIILSKYMVGIDIMKTELSPSRVQLSNNIMEANEKFLNNMKNVFHPSEWEYI------ 119 Query 111 EQQLRRFMRVWTVKEAFV 128 ++ + +FM WT+KE+FV Sbjct 120 QKDISKFMHYWTIKESFV 137 Lambda K H 0.328 0.138 0.452 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22424899233 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40