bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0191_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G21270.3 115 3e-25 > 3702.AT2G21270.3 Length=340 Score = 115 bits (289), Expect = 3e-25, Method: Compositional matrix adjust. Identities = 58/120 (48%), Positives = 82/120 (68%), Gaps = 0/120 (0%) Query 2 LEEGGIVTVTNVSLPKGTFVQLQPLETDFLDISNPKALLEMALRGYAALTKGEVVSLPFL 61 L+EG IV V NV+LPKGT+V+LQP TDFLDISNPKA+LE ALR Y+ LT G+ + +P+ Sbjct 115 LQEGDIVRVRNVTLPKGTYVKLQPHTTDFLDISNPKAILETALRNYSCLTSGDSIMVPYN 174 Query 62 DCVYHLRVADLRPAPAVSIVETDVEVEFKAPEEQQNPSPVPDPAADGGYISSDEASEPPE 121 + Y + + + +PA A+SI+ETD EV+F P + + P P+A G ++E + PE Sbjct 175 NKKYFIDIVETKPANAISIIETDCEVDFAPPLDYKEPERPTAPSAAKGPAKAEEVVDEPE 234 Lambda K H 0.312 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22998535989 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40