bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0143_orf1 Length=144 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0230072 211 4e-54 > 44689.DDB_0230072 Length=457 Score = 211 bits (537), Expect = 4e-54, Method: Composition-based stats. Identities = 98/143 (68%), Positives = 115/143 (80%), Gaps = 1/143 (0%) Query 2 VNVQPLSGSPANFAVFMALLQPHDRFMGLGLNDGGHLTHGAYTPSRRISASSLFFESLPY 61 VNVQP SGSPANFAV+ ALL+PHDR MGL L GGHLTHG T ++ISASS+FFES+PY Sbjct 97 VNVQPYSGSPANFAVYTALLRPHDRIMGLDLPSGGHLTHGYQTDKKKISASSIFFESMPY 156 Query 62 GLNPQTGLIDYEELDRLATLFRPKLIICGHSAYPRLLNYKRFRSIADKVGAFLWCDMAHF 121 + GLIDY+ L+ A LF+PKLII G SAYPR +YKR R+IADKVGA+L CDMAH+ Sbjct 157 QIGAD-GLIDYQRLEENALLFKPKLIISGASAYPREWDYKRMRAIADKVGAYLMCDMAHY 215 Query 122 SGFVAAGIFESPFDYCDVVTTTT 144 SG VAA + +SPFDYCDVVT+TT Sbjct 216 SGLVAAQLLDSPFDYCDVVTSTT 238 Lambda K H 0.326 0.141 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22567178795 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40