bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0102_orf1 Length=270 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0233 200 5e-50 > 5833.PF13_0233 Length=818 Score = 200 bits (508), Expect = 5e-50, Method: Composition-based stats. Identities = 88/158 (55%), Positives = 123/158 (77%), Gaps = 0/158 (0%) Query 1 IMEIVQASTNPVVKDLFAGIVMEKGKIAKGQLIGSQFLKQLEALMEPINSTEPHFVRCVK 60 ++E+++ S NP+V+ LF G V+EKGKIAKG LIGSQFL QL +LM INSTEPHF+RC+K Sbjct 609 LVEVIKDSPNPIVQQLFEGQVIEKGKIAKGSLIGSQFLNQLTSLMNLINSTEPHFIRCIK 668 Query 61 PNDTKKPLDWVQSKVLIQLHALSVLEALQLRQVGFSYRRPFKDFLYQFKFIDLGICENSS 120 PN+ KKPL+W + K+LIQLHALS+LEAL LRQ+G+SYRR F++FLYQ+KF+D+ E+SS Sbjct 669 PNENKKPLEWCEPKILIQLHALSILEALVLRQLGYSYRRTFEEFLYQYKFVDIAAAEDSS 728 Query 121 LSPRAACEALLEKSKVDRKQCQVGKTMIFLMAGGSEAL 158 + + C +L+ S + ++GK+M+FL G++ L Sbjct 729 VENQNKCVNILKLSGLSESMYKIGKSMVFLKQEGAKIL 766 Lambda K H 0.324 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 86768761680 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40