bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0068_orf1 Length=280 Score E Sequences producing significant alignments: (Bits) Value 3702.AT4G21940.1 116 9e-25 > 3702.AT4G21940.1 Length=554 Score = 116 bits (290), Expect = 9e-25, Method: Compositional matrix adjust. Identities = 69/214 (32%), Positives = 116/214 (54%), Gaps = 5/214 (2%) Query 1 AKDFISSLLRRNPEDRLTAAAALEHPWLAVEDGSIQRHTIDIEVLKSMRRFAACTAIQRA 60 AKD + LL ++P+ R++AA ALEHPW + G ID VL M++F A +++ Sbjct 333 AKDLVRKLLTKDPKQRISAAQALEHPW--IRGGEAPDKPIDSAVLSRMKQFRAMNKLKKL 390 Query 61 ALGLIAMSMPSKDLDELEKLFCALDEKKTGSIRVESLVNVLVKTLN-IPEAEAHRIFHRI 119 AL +IA S+ +++ L+ +F +D K+G+I E L N L K + + EAE ++ Sbjct 391 ALKVIAESLSEEEIKGLKTMFANMDTDKSGTITYEELKNGLAKLGSKLTEAEVKQLMEAA 450 Query 120 DLTGDQEINYSEFLAATFQTQVALSQSLIREAFERLDVDQSGEISLDNLRHILGDSYGGV 179 D+ G+ I+Y EF++AT + +AF+ D D SG I++D L + + G Sbjct 451 DVDGNGTIDYIEFISATMHRYRFDRDEHVFKAFQYFDKDNSGFITMDELESAMKEYGMGD 510 Query 180 LA--EEILQQCDIKKNGVIDFEEFMVALTGAVTF 211 A +E++ + D +G I++EEF + +T Sbjct 511 EASIKEVIAEVDTDNDGRINYEEFCAMMRSGITL 544 Lambda K H 0.317 0.130 0.352 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 92794370130 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40