bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0021_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 160492.XF0354 81.3 9e-15 > 160492.XF0354 Length=718 Score = 81.3 bits (199), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 39/112 (34%), Positives = 63/112 (56%), Gaps = 7/112 (6%) Query 41 AEVYRQLRRCVAAGHQAYWICPFVDGAHAAAAAAAAAGGSSSRWRRSSSREAGYGTATSA 100 E+ ++R A G Q YW+C +D + A A SS+ S +A T Sbjct 480 PELVERIRLACAQGRQVYWVCTLIDESQTEAEQAPP---SSNDIEHRSEVQAAQAT---- 532 Query 101 YNELRKKLPDIRIGILHGRLSCKEQEKVLGLFACNKISLLISTTIIEVGVDI 152 Y L +LP +R+G++HGR+ E+++ + F CN+I +L++TT+IEVGVD+ Sbjct 533 YEALSAQLPGVRVGLVHGRMKAAEKQRTMRAFKCNEIDVLVATTVIEVGVDV 584 Lambda K H 0.318 0.131 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40