bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0009_orf1 Length=161 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL012008-PA 91.3 1e-17 > 7159.AAEL012008-PA Length=522 Score = 91.3 bits (225), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 48/129 (37%), Positives = 75/129 (58%), Gaps = 10/129 (7%) Query 22 GLPFIDEYNNKLRHEGIGVIAYAGEEGGDKKKRNKSEFYITFKSCTHLDNKHTIFGRVVG 81 G F DE L H G G+++ A N S+F+IT++SC HLD KHTIFG++VG Sbjct 345 GKKFADEIRPNLTHSGRGILSMAN----SGPNTNGSQFFITYRSCRHLDGKHTIFGKLVG 400 Query 82 GLDVLRAWESLPVDKKDCPLSPLFIKKMHIYKNAFIIAKKEI------EEEKIKLANQEI 135 GL+VL E + VD +D P+ +FI+++ ++ + F+ A +E+ E E+++ QE Sbjct 401 GLEVLTEMERVEVDNRDRPIENIFIQRVQVFVDPFLEADEELAKQRSDELERVQREAQEK 460 Query 136 QAAKDAARP 144 Q A+P Sbjct 461 QKKTARAQP 469 Lambda K H 0.317 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26764363279 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40