bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0005_orf1 Length=111 Score E Sequences producing significant alignments: (Bits) Value 269798.CHU_1995 119 4e-26 > 269798.CHU_1995 Length=371 Score = 119 bits (297), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 53/91 (58%), Positives = 71/91 (78%), Gaps = 0/91 (0%) Query 2 RPTSHENPTYTIDGILHYGVTNMPGAVPVTATAALTNATLPYVLHLANSGWRDACMQSKP 61 +PTSHE+P + ++ I+HY V N+PGAVPVT+T ALTNA+LPY+L LA+ GW+DAC QS Sbjct 279 KPTSHEHPIFLVNDIIHYCVPNIPGAVPVTSTNALTNASLPYLLQLADKGWKDACRQSAE 338 Query 62 LYKGLAIAQGKVLHRGIAETFHLSLYSFDDL 92 + KGL+IA GKV +A+TF LSL++ DL Sbjct 339 IEKGLSIAAGKVTDAMLAKTFQLSLHNIKDL 369 Lambda K H 0.320 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23016794144 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40