bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_3235_orf1 Length=94 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_070770 hypothetical protein ; K12822 RNA-binding pr... 67.8 8e-12 cel:ZK637.11 cdc-25.3; Cell Division Cycle related family memb... 29.3 3.5 tpv:TP01_0682 60S ribosomal protein L17 28.1 7.7 ath:AT5G42670 agenet domain-containing protein 27.7 9.5 > tgo:TGME49_070770 hypothetical protein ; K12822 RNA-binding protein 25 Length=779 Score = 67.8 bits (164), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 30/53 (56%), Positives = 39/53 (73%), Gaps = 0/53 (0%) Query 42 LRKLDPEAIAAAAENSIYRIAPDGTDRRTYIEEDYRPSRRELERLQNAGRREA 94 L+ ++PE AA+ S+YR+ PDG DRR YI EDYRP RRELERL + RR++ Sbjct 375 LKAMNPELAEAASSCSVYRVGPDGVDRRRYITEDYRPCRRELERLHHLERRDS 427 > cel:ZK637.11 cdc-25.3; Cell Division Cycle related family member (cdc-25.3) Length=316 Score = 29.3 bits (64), Expect = 3.5, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Query 7 QHSSHKKESSKDKHKYSSSSKTAATDTSAGSAFHRLRK-LDP 47 +H HKK SK K+SS++ + T++G+ LR+ DP Sbjct 268 KHQFHKKNVSKPMKKWSSTTSVISILTTSGTRISTLRQTCDP 309 > tpv:TP01_0682 60S ribosomal protein L17 Length=260 Score = 28.1 bits (61), Expect = 7.7, Method: Compositional matrix adjust. Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Query 40 HRLRKLDPEAIA----AAAENSIYRIAPDGTDRRTYIEEDYRPSRRELERLQNAGRR 92 ++LR+ D +A EN IY P G D+ +I + +RR+ + N GR+ Sbjct 124 YKLRQRDSAPLAYIELVNTENEIYPAKPVGIDKLNHILNLMKSTRRDYRKYHNYGRK 180 > ath:AT5G42670 agenet domain-containing protein Length=294 Score = 27.7 bits (60), Expect = 9.5, Method: Composition-based stats. Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 13/94 (13%) Query 3 ELNQQHSSHKKESSKDKHKYSS---SSKTAATDTSAGSAFHRLRKLDPEAIAAAA---EN 56 +LN+ S + ++K + + K T+ +L +D E+I AA E Sbjct 201 QLNEDQVSEAESMEEEKQRGAEPKEEEKQRPTEKLKSDEALQLNIMDSESIEAAVLDLEE 260 Query 57 SIYR-------IAPDGTDRRTYIEEDYRPSRREL 83 I R + PD +++ ++I EDY PS + Sbjct 261 MIVRFEWLKDILTPDSSEKNSWIYEDYHPSSSRM 294 Lambda K H 0.306 0.121 0.324 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2069995292 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40